PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041888
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 223aa    MW: 25092.2 Da    PI: 6.5168
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041888genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEde+lv ++k +G g W++ ++  g+ R++k+c++rw +yl
      Lus10041888 14 KGAWSREEDERLVSYIKAHGEGGWRSLPKSAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.32.8e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +Edel+++++ +lG++ W+ Ia +++ gRt++++k++w+++l
      Lus10041888  67 RGNFSCQEDELIIRLHSLLGNK-WSVIAGKLP-GRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.794961IPR017930Myb domain
SMARTSM007171.0E-111363IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-2913108IPR009057Homeodomain-like
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001671.01E-81661No hitNo description
PROSITE profilePS5129425.66562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2765116IPR009057Homeodomain-like
SMARTSM007176.0E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001675.63E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRSPCCERA HTNKGAWSRE EDERLVSYIK AHGEGGWRSL PKSAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF SCQEDELIIR LHSLLGNKWS VIAGKLPGRT DNEIKNYWNT HLKRKLLGEG  120
IDPLTHRQIG SGEGKEEEEE GIAEGNGSVF SEEVVEGNDN SSGVGMSRER DEGTDEELNL  180
ELRMCPPSPR RHGPMSRPLE EEGSSNAVMV EGRKYWLVDM IR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383085.17e-87hypothetical protein POPTR_0005s11410g
SwissprotP813932e-85MYB08_ANTMA; Myb-related protein 308
TrEMBLU5GHF47e-87U5GHF4_POPTR; Uncharacterized protein
STRINGSolyc01g111500.2.14e-83(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-81myb domain protein 7